PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10018128m
Common NameEUTSA_v10018128mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family Nin-like
Protein Properties Length: 819aa    MW: 91477.1 Da    PI: 6.588
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10018128mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.71.3e-29550601152
           RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Thhalv10018128m 550 AEKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 601
                      589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.086535621IPR003035RWP-RK domain
PfamPF020421.3E-25553601IPR003035RWP-RK domain
SuperFamilySSF542774.42E-23710808No hitNo description
SMARTSM006661.1E-25720803IPR000270PB1 domain
PROSITE profilePS5174528.712720803IPR000270PB1 domain
PfamPF005641.5E-18721801IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2407.9E-20721800No hitNo description
CDDcd064071.43E-36721797No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 819 aa     Download sequence    Send to blast
MENNSLPMDS AMDSSFMDGL LLDGCWLETT DASEFLHFSP STSVTPFDPS SLMWSPTQDT  60
AICSSSLSQM YGQDCAERSS LEDHHQQGKD LSSLNRRWWI GPTGHGSSVM ERLVQAVKHI  120
KDFTSERGSL IQLWVPVDRG GKRVLTTKEQ PFSHDPMCQR LAHYREISVN YHFSTEQEDS  180
NSNSKDLVGL PGRVFLGQVP EWTPDVRFFK NEEYPRVQHA QDCDVRGTLA IPVFEQGSKI  240
CLGVIEVVMT TQMVKLSPEL ESICRALQAV DLRSTQVPIS PSLKGPDFSY QAALPEIRNL  300
LRCACETHKL PLAQTWVSCL KQSKTGCRHS DENYIHCVST IDDACYVGDP TVREFHEACS  360
EHHLLKGQGV VGEAFLTNGP CFSSDVSSYK KSEYPLAHHA TMFGLHGTVA IRLRCIHTGS  420
ADFVLEFFLP KNCRDVEEQR KMLNALSTIM AHVPKSLRTV TEKELEVEGD SMASEVIERA  480
ETLPKIENIS EVHQSNAVPK NVGLVFDGGT SEIGELGFDY GKGLSVNENS NFSSASGGFS  540
RMTERKRTKA EKNITLDVLR QYFAGSLKDA AKSIGVCPTT LKRICRQHGI QRWPSRKIKK  600
VGHSLQKIQR VIDSVQGVSG HHLPIGSFYA NFPNLASSHE ASSLQQQSNK TTFLSSSHSL  660
PAKSPASSCS HSSSCSSETQ VNKEDPTNKT REDTMKLSRS FKETRATQLS PSTSSQDDDF  720
LRIKVSYEEE KIRFRMRNSR SLKDLLWEIA KRFGIEDVSR YDLKYLDEDN EWVLLRCDDD  780
VEECVDVCRS FPGQTIKLLL QLSSQHLPER SSVSGCLS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935370.0AB493537.1 Arabidopsis thaliana At1g76350 mRNA for hypothetical protein, partial cds, clone: RAAt1g76350.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390206.10.0hypothetical protein EUTSA_v10018128mg
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLV4KCL80.0V4KCL8_EUTSA; Uncharacterized protein
STRINGAT1G76350.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein